PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Migut.C00771.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe
Family TALE
Protein Properties Length: 527aa    MW: 59215.8 Da    PI: 6.0089
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Migut.C00771.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox27.74.5e-093323691954
                       HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
          Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                       Fe   ++yp+ +e+  LA+++gLt +qV +WF N R +
  Migut.C00771.1.p 332 FEHflHPYPKDSEKIVLARETGLTRSQVANWFINARVR 369
                       554459******************************88 PP

2BELL1085.9e-35195266172
              BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                       er+++q+k + L s+l+eVd+rYkqy +q+q++ ssF++vag g+a pYt+lAl++iSr+FrcL+d i++qi
  Migut.C00771.1.p 195 ERNDMQNKLTALFSMLDEVDRRYKQYWHQMQVMSSSFDTVAGSGAALPYTALALRTISRQFRCLRDGIKKQI 266
                       7899*******************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005741.1E-43133264IPR006563POX domain
PfamPF075262.6E-40141262IPR006563POX domain
PROSITE profilePS5007112.276310373IPR001356Homeobox domain
SMARTSM003896.5E-10313377IPR001356Homeobox domain
CDDcd000864.43E-12313374No hitNo description
SuperFamilySSF466894.71E-17314380IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.1E-27316379IPR009057Homeodomain-like
PfamPF059207.2E-17330369IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 527 aa     Download sequence    Send to blast
MASFYSNSSG ESYMLNQTLV NNNKVYDSSI SLSYPNLLSG HELVESDAQM YSKEPFINSE  60
QISQYHGLSL TLGSHEEPSM VHHQFHSDLN HYANSSSLCS LLNSENALKN VQYLSFDLSE  120
KTRDASSFIM PSQNFTGTSC NSKYLKAAQD LLDELVSVHK CTKLSEKVHN FDSLISGQAH  180
VKRDDGVCVD LSPSERNDMQ NKLTALFSML DEVDRRYKQY WHQMQVMSSS FDTVAGSGAA  240
LPYTALALRT ISRQFRCLRD GIKKQIQATQ RILGGEHDGS SHSQGVLSRL RHVDQQLRQQ  300
KSISQFGGMR QPWRPQRGLP ENAVSVLRAW LFEHFLHPYP KDSEKIVLAR ETGLTRSQVA  360
NWFINARVRL WKPMIEEMYK EEFGDAETEA RSSPTTQEVP TFDELRDEEF RGGSLISAAE  420
DENGVFVNFG PSHMDSRHIV NVGDGFFSDK NNASPPKNQV SLALGLQNSE EDSKLIFNGI  480
QPKGNEGDSS SSSVPLDKLE YYYVDPVNNN QSRFGNNTHL MSDFVA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrm_A8e-17319377563Homeobox protein Meis2
4xrm_B8e-17319377563Homeobox protein Meis2
4xrs_A7e-17319376158Homeobox protein Meis1
4xrs_B7e-17319376158Homeobox protein Meis1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012842786.10.0PREDICTED: BEL1-like homeodomain protein 7
TrEMBLA0A022QYA00.0A0A022QYA0_ERYGU; Uncharacterized protein
STRINGPGSC0003DMT4000096101e-127(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA112582022
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G16400.11e-110BEL1-like homeodomain 7